If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QLEQIPEQLR
Peptide within the protein Oat-gluten-P80356:
MKTFLIFALLAMAATMATAQFDPSEQYQPYPEQQQPILQQQQMLLQQQQQMLLQQQPLLQVLQQQLNPCRQFLVQQCSPVAVVPFLRSQILQQSSCQVMRQQCCRQLEQIPEQLRCPAIHSVVQAIIMQQQQFFQPQMQQQFFQPQMQQVTQGIFQPQMQQVTQGIFQPQLQQVTQGIFQPQMQGQIEGMRAFALQALPAMCDVYVPPHCPVATAPLGGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QLEQIPEQLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Avena canariensis | Avena canariensis | CCC80642 |
146532 |
| Avena damascena | Avena damascena | CCC80649 |
283873 |
| Avena insularis | Avena insularis | CCC80666 |
283872 |
| Avena longiglumis | Avena longiglumis | CCC80654 |
4500 |
| Avena macrostachya | Avena macrostachya | CCC80666 |
106814 |
| Avena magna | Avena magna | CCC80666 |
283874 |
| Avena prostrata | Avena prostrata | CCC80655 CCC80641 |
279683 |
| Avena sativa | Oat | AAB32025 CBL51490 AGB56862 ABD14148 CBL51495 P80356 AGB56873 |
4498 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.